Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

SAB2108468

Sigma-Aldrich

Anti-FOXA3

affinity isolated antibody

Sinônimo(s):

Anti- HNF3G, Anti- TCF3G, Anti-FKHH3

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

37 kDa

reatividade de espécies

dog, guinea pig, rat, bovine, human

concentração

0.5-1 mg/mL

técnica(s)

immunoblotting: suitable
immunohistochemistry: suitable

nº de adesão

NM_004497

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... FOXA3(3171)

Descrição geral

Forkhead box A3 (FOXA3), also known as hepatocyte nuclear factor 3 γ (HNF3γ), is encoded by the gene mapped to human chromosome 19q13.32. The encoded protein belongs to the Foxa subfamily. FOXA3 is characterized with a homologous forkhead DNA-binding domain and two transcriptional activation domains located at the N- and C-terminal.

Imunogênio

Synthetic peptide directed towards the middle region of human FOXA3

Ações bioquímicas/fisiológicas

Forkhead box A3 (FOXA3) plays a vital role in maintenance of cell glucose homeostasis during prolonged fast. It is also implicated in the regulation of fat mass in humans. FOXA3 inhibits innate immunity and increases the risk of susceptibility to viral infections associated with chronic lung disorders accompanied by chronic goblet cell metaplasia.

Sequência

Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity.
Chen G, et al.
American Journal of Respiratory and Critical Care Medicine, 189, 301-313 (2014)
Foxa3 (hepatocyte nuclear factor 3gamma ) is required for the regulation of hepatic GLUT2 expression and the maintenance of glucose homeostasis during a prolonged fast.
Shen W, et al.
The Journal of Biological Chemistry, 276, 42812-42817 (2001)
SnapShot: forkhead transcription factors I.
Tuteja G andKaestner KH.
Cell, 130, 1160-1160 (2007)
Casandra Walker et al.
International journal of molecular sciences, 24(2) (2023-01-22)
Perinatal exposure to endocrine disrupting chemicals (EDCs) has been shown to affect male reproductive functions. However, the effects on male reproduction of exposure to EDC mixtures at doses relevant to humans have not been fully characterized. In previous studies, we
Analysis of variants and mutations in the human winged helix FOXA3 gene and associations with metabolic traits
Adler-Wailes DC, et al.
International journal of obesity (2005), 39, 888-892 (2015)

Global Trade Item Number

SKUGTIN
SAB2108468-100UL4061836135980

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica