SAB2108151

Anti-HNF1B antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-ADTKD3, Anti-FJHN, Anti-HNF-1-beta, Anti-HNF-1B, Anti-HNF1beta, Anti-HNF2, Anti-HPC11, Anti-LF-B3, Anti-LFB3, Anti-MODY5, Anti-RCAD, Anti-T2D, Anti-TCF-2, Anti-TCF2, Anti-VHNF1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 61kDa
• reatividade de espécies: bovine, human, horse, pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunoblotting: suitable
• nº de adesão NCBI: NM_000458
• nº de adesão UniProt: P35680
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HNF1B(6928)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human HNF1B

Ações bioquímicas/fisiológicas

HNF1B is a member of the transcription factor superfamily. It forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined.This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-473 DC340648.1 1-473 474-1994 BC017714.1 441-1961 1995-2544 AC091199.6 29528-30077 2545-2842 AI797324.1 1-298 c

Sequência

Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable