SAB2104637

Anti-ATP7A antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-MK, Anti-MNK
• Número MDL: MFCD03455449
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• peso molecular: 163 kDa
• reatividade de espécies: horse, rat, human, mouse, dog, guinea pig, rabbit, bovine
• embalagem: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NM_000052
• nº de adesão UniProt: Q04656
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ATP7A(538)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human ATP7A

Ações bioquímicas/fisiológicas

The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Gol

Sequência

Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable