SAB2104153

Anti-ZFR antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-FLJ41312
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 117 kDa
• reatividade de espécies: bovine, rat, mouse, horse, human, rabbit, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NM_016107
• nº de adesão UniProt: Q96KR1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ZFR(51663)

Descrição

Descrição geral

Zinc finger RNA binding protein (ZFR) is a highly conserved protein and is homologous to mouse ZFR. It is essential in the early developmental stages. ZFR has three N-terminal C2H2 zinc finger motifs and a C-terminal DZF (domain associated with zinc fingers) domain. ZFR is highly expressed in brain, whereas skeletal muscles is devoid of ZFR expression. In human chromosome, the gene ZFR is localized on 5p13.3.

Imunogênio

Synthetic peptide directed towards the middle region of human ZFR

Aplicação

Anti-ZFR antibody produced in rabbit has been used in western blot analysis.

Ações bioquímicas/fisiológicas

Zinc finger RNA binding protein (ZFR) binds to RNA and DNA and promotes DNA repair and chromosome organisation. ZFR regulates alternative pre-mRNA splicing and suppress interferon 1 expression in tissues. ZFR is a key factor in regulating transcription in macrophages. ZFR is critical for Staufen 2 isoform specific nucleocytoplasmic shuttling in neurons. ZFR is a potent marker and therapeutic target in cancer. ZFR is highly expressed in pancreatic cancer and knockdown of which suppressed the tumor cell growth and proliferation. ZFR is overexpressed in non-small-cell lung carcinoma (NSCLC) and causes cell growth and metastasis.

Sequência

Synthetic peptide located within the following region: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable