SAB2102648

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-DKFZp434B0920, Anti-DKFZp686G0837, Anti-MGC33463, Anti-NIRF, Anti-Ubiquitin-like, containing PHD and RING finger domains, 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 90 kDa
• reatividade de espécies: guinea pig, horse, rabbit, human, mouse, dog, bovine, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão UniProt: Q96PU4
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... UHRF2(115426)

Descrição

Descrição geral

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) belongs to the ubiquitin plant homeodomain RING finger (UHRF) family. The gene is located on human chromosome 9p24.1. The protein consists of ubiquitin-like (UBL) domain, tandem tudor domain (TTD), plant homeodomain (PHD) finger domain, SET and RING associated (SRA) domain and RING finger domain.

Imunogênio

Synthetic peptide directed towards the middle region of human UHRF2

Ações bioquímicas/fisiológicas

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
UHRF2 is overexpressed in colorectal cancer cells and functions as an oncogene in breast cancer cells. UHRF2 domains are required for the regulation of cell cycle network, epigenetic system and UPS (ubiquitin proteasome system). The protein plays an important role in the nuclear degradation of polyglutamine aggregates. UHRF2 is involved in the DNA damage repair of aortic vascular smooth muscle cells.

Sequência

Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable