SAB2101765

Anti-PDS5B antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-APRIN, Anti-AS3, Anti-CG008, Anti-FLJ23236, Anti-PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 159 kDa
• reatividade de espécies: horse, mouse, rabbit, rat, bovine, dog, human, pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão UniProt: Q9NTI5
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PDS5B(23047)

Descrição

Descrição geral

PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Imunogênio

Synthetic peptide directed towards the middle region of human PDS5B

Sequência

Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable