SAB2100200

Anti-BACE1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-β-Site APP-cleaving enzyme 1, Anti-ASP2, Anti-BACE, Anti-FLJ90568, Anti-HSPC104
• Número MDL: MFCD03096637
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 51 kDa
• reatividade de espécies: rabbit, bovine, guinea pig, mouse, rat, horse, dog, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunofluorescence: suitable; immunohistochemistry: suitable; western blot: suitable
• nº de adesão UniProt: P56817
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... BACE1(23621)

Descrição

Descrição geral

β-site APP cleaving enzyme (BACE-1) is known as β-secretase. It consists of an N-terminal signal peptide (SP), a pro-peptide (Pro) domain, a catalytic domain, a transmembrane domain and a C-terminal tail.

BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Imunogênio

Synthetic peptide directed towards the N terminal region of human BACE1

Ações bioquímicas/fisiológicas

β-site APP cleaving enzyme (BACE-1) acts as a rate-limiting enzyme of amyloid-β-peptide (Aβ). Overexpression of BACE-1 leads to increased β-secretase activity.

Sequência

Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable