Pular para o conteúdo
Merck
Todas as fotos(5)

Key Documents

SAB1412362

Sigma-Aldrich

ANTI-TBX18 antibody produced in mouse

clone 4D3, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

TBX18

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

4D3, monoclonal

forma

buffered aqueous solution

peso molecular

antigen 37.4 kDa

reatividade de espécies

, human,

técnica(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão NCBI

XM_496819

nº de adesão UniProt

O95935

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TBX18(9096)

Descrição geral

T-box transcription factor 18 (TBX18) belongs to the TBX family of transcription factors. It contains a conserved T-box domain and an N-terminal nuclear localization signal (NLS). The TBX18 gene is mapped to human chromosome 6q14.3

Imunogênio

TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF

Aplicação

ANTI-TBX18 antibody produced in mouse has been used in immunofluorescence staining.

Ações bioquímicas/fisiológicas

T-box transcription factor 18 (TBX18) is involved in the sinoatrial node (SAN) formation and is expressed in the development and differentiation stages. It is a crucial factor for the pacemaker cell formation from cardiomyocytes. TBX18 may be implicated in congenital heart defects and congenital anomalies of the kidneys and urinary tract (CAKUT).

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

NODAL inhibition promotes differentiation of pacemaker-like cardiomyocytes from human induced pluripotent stem cells
Yechikov S, et al.
Stem Cell Research (2021)
Soumya Negi et al.
Developmental biology, 446(2), 180-192 (2018-12-31)
The evolutionarily conserved transcription factor, Tbx18, is expressed in a dynamic pattern throughout embryonic and early postnatal life and plays crucial roles in the development of multiple organ systems. Previous studies have indicated that this dynamic function is controlled by
Aafke Engwerda et al.
European journal of human genetics : EJHG, 26(10), 1478-1489 (2018-06-16)
Proximal 6q (6q11-q15) deletions are extremely rare and little is known about their phenotypic consequences. Since parents and caregivers now use social media to seek information on rare disorders, the Chromosome 6 Project has successfully collaborated with a Facebook group
Asaf Vivante et al.
American journal of human genetics, 97(2), 291-301 (2015-08-04)
Congenital anomalies of the kidneys and urinary tract (CAKUT) are the most common cause of chronic kidney disease in the first three decades of life. Identification of single-gene mutations that cause CAKUT permits the first insights into related disease mechanisms.

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica