Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

SAB1412264

Sigma-Aldrich

ANTI-SP1 antibody produced in mouse

clone 1G9, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

SP1

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1G9, monoclonal

Formulário

buffered aqueous solution

peso molecular

antigen 36.41 kDa

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SP1(6667)

Descrição geral

Sp1 protein was the first transcription factor to be cloned and characterized. It was first detected in HeLa cells on the basis of its ability to activate the SV40 early promoter transcription. Analysis of structure and function has revealed that Sp1 can be separated into discrete functional domains. The DNA-binding domain consists of three zinc fingers that specifically bind to the GC-box element.

Imunogênio

SP1 (NP_612482, 522 a.a. ~ 618 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*

Ações bioquímicas/fisiológicas

Sp1 protein was shown to recognize and bind selectively to a GC-rich consensus sequence (GC-box: GGGCGG or CACCC) that presents in the promoter of several important cellular genes, including Simian vacuolating virus 40 (SV40) early, human immunodeficiency virus-1 (HIV-1), platelet-derived growth factor subunit B (PDGF-B), Myc, c-Src etc. In addition to transcription, Sp1 function has been linked to cell growth, cancer and Huntington disease.

forma física

Solution in phosphate buffered saline, pH 7.4

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Structures of zinc finger domains from transcription factor Sp1. Insights into sequence-specific protein-DNA recognition.
Narayan VA
The Journal of Biological Chemistry, 272(12), 7801-7809 (1997)
Decreased association of the transcription factor Sp1 with genes downregulated in Huntington's disease.
Chen-Plotkin AS
Neurobiology of Disease, 22(2), 233-241 (2006)
Mithramycin is a gene-selective Sp1 inhibitor that identifies a biological intersection between cancer and neurodegeneration.
Sleiman SF
The Journal of Neuroscience, 31(18), 6858-6870 (2011)
Deepti Malik et al.
Molecular cancer, 13, 175-175 (2014-07-20)
microRNAs (miRNAs) play both oncogenic and oncostatic roles in leukemia. However, the molecular details underlying miRNA-mediated regulation of their target genes in pediatric B- and T-cell acute lymphoblastic leukemias (ALLs) remain unclear. The present study investigated the relationship between miR-2909
Carolina Vizcaíno et al.
PloS one, 9(8), e104687-e104687 (2014-08-12)
Ovarian cancer has a poor prognosis due to intrinsic or acquired resistance to some cytotoxic drugs, raising the interest in new DNA-binding agents such as mithramycin analogues as potential chemotherapeutic agents in gynecological cancer. Using a genome-wide approach, we have

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica