SAB1402231

Monoclonal Anti-HRH1 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): H1-R, hisH1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3D1, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.44 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; proximity ligation assay: suitable
• Isotipo: IgG1κ
• nº de adesão NCBI: NM_000861
• nº de adesão UniProt: P35367
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HRH1(3269)

Descrição

Descrição geral

Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless until recently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Imunogênio

HRH1 (NP_000852.1, 312 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable