SAB1402125

Monoclonal Anti-ATP6V1A, (C-terminal) antibody produced in mouse

clone 4F5, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): ATP6A1, ATP6V1A1, HO68, VA68, VPP2, Vma1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4F5, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~38.21 kDa
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão NCBI: NM_001690
• nº de adesão UniProt: P38606
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ATP6V1A(523)

Descrição

Descrição geral

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c′, c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. (provided by RefSeq)

Imunogênio

ATP6V1A (NP_001681, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED

Ações bioquímicas/fisiológicas

The vacuolar-ATPases significantly control the internal pH by maintaining it neutral. ATP6V1A (ATPase H⁺ transporting V1 subunit A) is known to be associated with the acidification and intracellular trafficking of secretory granules, endosomes, and lysosomes. Mutations in the gene affect the structure and organisation of V-ATPase, glycosylation of proteins, Golgi trafficking. Mutations can also affect the lysosomal function and results in abnormal extracellular matrix homeostasis. ATP6V1A might serve as a prognostic factor in gastric cancer.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable