SAB1401272

Monoclonal Anti-OMP antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

• Número MDL: MFCD09265364
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2B7, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_006189
• nº de adesão UniProt: P47874
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... OMP(4975)

Descrição

Descrição geral

Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. (provided by RefSeq)

Imunogênio

OMP (NP_006180.1, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable