MSST0045

SILu^™Prot TIMP2, Metalloproteinase inhibitor 2 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Código UNSPSC: 23201100
• NACRES: NA.12

Propriedades

• recombinante: expressed in HEK 293 cells
• Nível de qualidade: 200
• Ensaio: ≥98% (SDS-PAGE)
• Formulário: lyophilized powder
• potência: ≥98% Heavy amino acids incorporation efficiency by MS
• adequação: suitable for mass spectrometry (standard)
• nº de adesão UniProt: P16035
• temperatura de armazenamento: −20°C

Descrição

Descrição geral

SILu^™Prot TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and ^[13C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILu^™Prot TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.

Ações bioquímicas/fisiológicas

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.

Sequência

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable