HPA037655

Anti-GUCY2C antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-GUC2C, Anti-Guanylate cyclase 2C (heat stable enterotoxin receptor), Anti-STAR
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA037655
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry: 1:200-1:500
• sequência de imunogênio: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
• nº de adesão UniProt: P25092
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GUCY2C(2984)

Descrição

Descrição geral

The guanylate cyclase 2C (GUCY2C) gene, mapped to human chromosome 12p12, codes for the transmembrane receptor guanylate cyclase C (GC-C). The encoded protein is expressed in intestine.

Imunogênio

guanylate cyclase 2C (heat stable enterotoxin receptor) recombinant protein epitope signature tag (PrEST)

Aplicação

GUCY2C antibody produced in rabbit has been used for western blot analysis.

Ações bioquímicas/fisiológicas

Transmembrane receptor guanylate cyclase C (GC-C), encoded by guanylate cyclase 2C (GUCY2C), regulates the secretion of chloride. Alteration in the gene expression leads to congenital sodium diarrhoea (CSD). GUCY2C catalyzes the conversion of guanosine-5′-triphosphate (GTP) to cyclic guanosine monophosphate (cGMP), upon binding of its ligand guanylin and uroguanylin, which are paracrine hormones. GUCY2C functions as a tumor suppressor and hinders intestinal tumorigenesis by inhibiting the protein kinase B/AKT signaling pathway.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST79587

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable