HPA035981

Anti-PDCD1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-CD279, Anti-PD1, Anti-SLEB2, Anti-hSLE1
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA035981
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• sequência de imunogênio: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
• nº de adesão UniProt: Q15116
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PDCD1(5133)

Descrição

Descrição geral

The gene PDCD1 (programmed cell death protein 1) is mapped to human chromosome 2q37. The encoded protein belongs to the CD28 superfamily. It interacts with its ligands PD-L1/PD-L2 (programmed death-ligands).

Imunogênio

programmed cell death 1 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-PDCD1 antibody produced in rabbit has been used for immunohistochemistry.

These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

PDCD1 (programmed cell death protein 1) plays an important role in the immune regulation by working as a negative co-stimulatory factor. It suppresses working and multiplication of the T cells, thereby reducing the release of IL-2 (interleukin-2), IL-10 and IFN-γ (interferon γ). In the presence of tumor microenvironment, PDCD1 along with its ligand modulates T effector functioning, thereby protecting cancer cells from immune-associated rejection. Mutation in this gene is associated with symptoms and progression of multiple sclerosis. Mutation in it are also linked with susceptibility to systemic lupus erythematosus.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70027

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable