HPA029691
Anti-SIRT4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
Sinônimo(s):
Anti-SIR2L4, Anti-sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
reatividade de espécies
human
validação aprimorada
recombinant expression
Learn more about Antibody Enhanced Validation
técnica(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
sequência de imunogênio
VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... SIRT4(23409)
Descrição geral
SIRT4 (sirtuin 4) belongs to sirtuin family of nicotinamide adenine dinucleotide-dependent enzymes. It is a NAD+-dependent ADP ribosyltransferase, that is located in the mitochondria. SIRT4 protein level is found to be more in ESCC (esophageal squamous cell carcinoma) tissues.
Imunogênio
sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-SIRT4 has been used in immunohistochemistry.
Ações bioquímicas/fisiológicas
SIRT4 (sirtuin 4) may involve in the development of esophageal cancer. Growth of HeLa cells can be suppressed by the overexpression of SIRT4. It modulates glutamine metabolism and may also act as a tumor suppressor. It plays some important roles in multiple cellular processes like stress response and longevity. It may act as an important therapeutic target in colorectal cancer.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST78151
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Tumour-suppressive function of SIRT4 in human colorectal cancer
Miyo M, et al.
British Journal of Cancer, 113(3), 492-499 (2015)
Kristin A Anderson et al.
Cell metabolism, 25(4), 838-855 (2017-04-06)
Sirtuins are NAD+-dependent protein deacylases that regulate several aspects of metabolism and aging. In contrast to the other mammalian sirtuins, the primary enzymatic activity of mitochondrial sirtuin 4 (SIRT4) and its overall role in metabolic control have remained enigmatic. Using
SIRT4 is upregulated in Chinese patients with esophageal cancer
Lai X, et al.
International Journal of Clinical and Experimental Pathology, 9(10), 10543-10549 (2016)
Zhouxun Chen et al.
OncoTargets and therapy, 12, 2397-2408 (2019-04-18)
SIRT4, a protein localized in the mitochondria, is one of the least characteristic members of the sirtuin family. It is known that SIRT4 has deacetylase activity and plays a role in energy metabolism, but little is known about its possible
β-Cell-specific ablation of sirtuin 4 does not affect nutrient-stimulated insulin secretion in mice.
Frank K Huynh et al.
American journal of physiology. Endocrinology and metabolism, 319(4), E805-E813 (2020-09-01)
Sirtuins are a family of proteins that regulate biological processes such as cellular stress and aging by removing posttranslational modifications (PTMs). We recently identified several novel PTMs that can be removed by sirtuin 4 (SIRT4), which is found in mitochondria.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica