Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA019880

Sigma-Aldrich

Anti-CBLB antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Casitas B-lineage lymphoma proto-oncogene b, Anti-E3 ubiquitin-protein ligase CBL-B, Anti-RING finger protein 56, Anti-SH3-binding protein CBL-B, Anti-Signal transduction protein CBL-B

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

recombinant expression
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL

sequência de imunogênio

DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CBLB(868)

Descrição geral

CBLB (Cbl proto-oncogene B) is an E3 ubiquitin protein ligase belonging to the CBL protein family. It is mapped to human chromosome 3q13.11. In mammals, there are three homologues of Cbl, namely c-Cbl, Cbl-b and Cbl-c. It is composed of highly conserved tyrosine kinase binding (TKB) domain and new gene (RING) finger catalytic domains.

Imunogênio

E3 ubiquitin-protein ligase CBL-B recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-CBLB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

CBLB (Cbl proto-oncogene B) plays a crucial role in the regulation of immune cell activation. Both the domains perform different activities in ubiquitin ligase activity, such as TKB domain interacts directly with phosphorylated tyrosine-containing proteins through Src homology (SH) 2 domains and RING finger domain binds to E2 ubiquitin-conjugating. CBLB is phosphorylated upon T cell receptor (TCR) stimulation and is involved in TCR-mediated intracellular signaling pathways enzymes. Similarly, phosphorylated CBLB is recruited to epidermal growth factor receptor (EGFR) upon EGF stimulation and inhibits EGF-induced cell growth. CBLB participates in controlling T-cell activation thresholds by negative regulation of Vav, a GDP/GTP exchange factor. The molecular mechanism involves CBLB-mediated degradation of p85 regulatory subunit of phosphatidylinositol 3-kinase, an upstream regulator of Vav. CBLB is associated with an autoimmune disease of the central nervous system, multiple sclerosis.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73955

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Tomoki Abe et al.
Endocrine journal, 61(6), 529-538 (2014-03-13)
Obesity causes type 2 diabetes, atherosclerosis and cardiovascular diseases by inducing systemic insulin resistance. It is now recognized that obesity is related to chronic low-grade inflammation in adipose tissue. Specifically, activated immune cells infiltrate adipose tissue and cause inflammation. There
C Elly et al.
Oncogene, 18(5), 1147-1156 (1999-02-18)
Cbl-b, a mammalian homolog of Cbl, consists of an N-terminal region (Cbl-b-N) highly homologous to oncogenic v-Cbl, a Ring finger, and a C-terminal region containing multiple proline-rich stretches and potential tyrosine phosphorylation sites. In the present study, we demonstrate that
D Fang et al.
The Journal of biological chemistry, 276(7), 4872-4878 (2000-11-23)
Cbl-b is implicated in setting the threshold of T lymphocyte activation. In Cbl-b-deficient T cells, the activation of Vav, a guanine nucleotide exchange factor, is significantly enhanced. The molecular mechanism underlying Cbl-b-regulated Vav activation was unclear. Here it is shown
S A Ettenberg et al.
Oncogene, 18(10), 1855-1866 (1999-03-23)
The role of cbl-b in signaling by the epidermal growth factor receptor (EGFR) was studied and compared with c-cbl. We demonstrate in vivo, that cbl-b, like c-cbl, is phosphorylated and recruited to the EGFR upon EGF stimulation and both cbl
Jezabel Varadé et al.
Multiple sclerosis (Houndmills, Basingstoke, England), 18(7), 959-965 (2011-12-24)
Ten genes previously showing different evidence of association with multiple sclerosis have been selected to validate. Eleven polymorphisms were genotyped with the iPLEX™ Sequenom in a well-powered collection of Spanish origin including 2863 multiple sclerosis cases and 2930 controls. Replication

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica