HPA010926
Anti-ALCAM antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-Activated leukocyte-cell adhesion molecule antibody produced in rabbit, Anti-CD166 antigen precursor antibody produced in rabbit
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
reatividade de espécies
human
validação aprimorada
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnica(s)
immunohistochemistry: 1:50-1:200
sequência de imunogênio
NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... ALCAM(214)
Descrição geral
Activated leukocyte cell adhesion molecule (ALCAM) belongs to the superfamily of immunoglobulin cell adhesion molecules (Ig-CAMs). Its extracellular domain consist of five immunoglobulin (Ig)-like domains, which aid in cell-cell adhesion, either through heterophilic (ALCAM-CD6) or homophilic (ALCAM-ALCAM) interactions. It is a type I transmembrane protein. It has a short cytoplasmic tail and a transmembrane region, and has a molecular weight of 110kDa. It is expressed in a wide range of tissues, especially in the epithelia and the corresponding cancers. ALCAM gene maps to human chromosome 3q13.1-q13.2.
Imunogênio
CD166 antigen precursor recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-ALCAM antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
Activated leukocyte cell adhesion molecule (ALCAM) mediates cell-cell adhesion, either through heterophilic (ALCAM-CD6) or homophilic (ALCAM-ALCAM) interactions. Hemophilic interactions aid in cell migration and invasiveness of tumor cells. ALCAM present on dendritic cells, induces T-cell activation by interacting with cluster of differentiation 6 (CD6) present on T-cells. This heterophilic interaction is necessary for the stabilization of immunological synapses. It mediates the extravasation of leukocytes and their transport to the central nervous system, as well as axonal fasciculation. Colorectal cancer patients, who show increased levels of ALCAM shedding, have poor prognosis and survival rates. The soluble form of ALCAM is related to the aggressive type II phenotype of epithelial ovarian cancer, and can be used as a marker for the same.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST72229
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Futoshi Ishiguro et al.
The Journal of surgical research, 179(1), 24-32 (2012-09-19)
Activated leukocyte cell adhesion molecule (ALCAM) has been shown to correlate with the prognosis of patients with various types of human malignancies. However, the relationship between ALCAM expression and progression of non-small-cell lung cancer (NSCLC) has not been investigated. This
ALCAM: Basis Sequence: Mouse.
Amanda G Hansen et al.
The AFCS-nature molecule pages, 2011 (2011-01-01)
Joost Te Riet et al.
Journal of cell science, 127(Pt 7), 1595-1606 (2014-02-06)
At the immunological synapse, the activated leukocyte cell adhesion molecule (ALCAM) on a dendritic cell (DC) and CD6 molecules on a T cell contribute to sustained DC-T-cell contacts. However, little is known about how ALCAM-CD6 bonds resist and adapt to
Grazia Carbotti et al.
International journal of cancer, 132(11), 2597-2605 (2012-11-22)
Activated leukocyte cell adhesion molecule (ALCAM) is involved in cell-cell interactions in cancer. Shedding of its ectodomain by the metalloprotease ADAM17/TACE generates a soluble form (sALCAM). Here, we show that serum sALCAM levels were significantly higher in epithelial ovarian cancer
Amanda G Hansen et al.
Cancer research, 73(10), 2955-2964 (2013-03-30)
Molecular biomarkers of cancer are needed to assist histologic staging in the selection of treatment, outcome risk stratification, and patient prognosis. This is particularly important for patients with early-stage disease. We show that shedding of the extracellular domain of activated
Artigos
Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica