HPA002913
Anti-GPM6B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-M6b antibody produced in rabbit, Anti-Neuronal membrane glycoprotein M6-b antibody produced in rabbit
Faça loginpara ver os preços organizacionais e de contrato
About This Item
conjugado:
unconjugated
application:
IHC
clone:
polyclonal
reatividade de espécies:
human
citations:
6
técnica(s):
immunohistochemistry: 1:50- 1:200
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
Formulário
buffered aqueous glycerol solution
reatividade de espécies
human
técnica(s)
immunohistochemistry: 1:50- 1:200
sequência de imunogênio
AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... GPM6B(2824)
Descrição geral
Neuronal membrane glycoprotein M6-b is a protein encoded by the GPM6B gene in humans and is located at Xp22.2. The protein belongs to the proteolipid protein family.
Imunogênio
Neuronal membrane glycoprotein M6-b recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-GPM6B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
Neuronal membrane glycoprotein M6-b is a protein encoded by the GPM6B gene in humans and is located at Xp22.2. The protein belongs to the proteolipid protein family. It plays an important role in neural development. Defect in this gene is associated with several neurological disorders such as Aicardi syndrome, Rett syndrome, X-linked Charcot-Marie-Tooth neuropathy and X-linked mental retardation syndromes. The gene is up-regulated during osteoblast differentiation. It is a novel regulator of osteoblast function and bone formation. The gene is considered as a good candidate gene for Pelizaeus-Merzbacher-like syndrome.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST74334
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Ksenija Drabek et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 26(9), 2045-2051 (2011-06-04)
Neuronal membrane glycoprotein gene (GPM6B) encodes a membrane glycoprotein that belongs to the proteolipid protein family. We identified GPM6B as a gene that is strongly upregulated during osteoblast differentiation. To investigate the role of GPM6B in the process of bone
Ellen C Kammula et al.
PloS one, 7(12), e51578-e51578 (2013-01-04)
HIV-1 Nef protein contributes essentially to the pathology of AIDS by a variety of protein-protein-interactions within the host cell. The versatile functionality of Nef is partially attributed to different conformational states and posttranslational modifications, such as myristoylation. Up to now
S Olinsky et al.
Genomics, 33(3), 532-536 (1996-05-01)
M6 is a neuronal membrane glycoprotein that may have an important role in neural development. This molecule was initially defined by a monoclonal antibody that affected the survival of cultured cerebellar neurons and the outgrowth of neurites. The nature of
Marco Henneke et al.
American journal of medical genetics. Part A, 128A(2), 156-158 (2004-06-24)
"Pelizaeus-Merzbacher-like syndrome" is an undetermined leukodystrophy disorder of diffuse hypomyelination. The patients' clinical phenotype is indistinguishable from classical Pelizaeus-Merzbacher disease (PMD), but the patients lack PLP1 gene duplications or mutations. They represent about 20% of all cases with a clinical
V Narayanan et al.
American journal of medical genetics, 78(2), 165-168 (1998-07-23)
Human Xp22.2 has been proposed as a candidate region for the Rett syndrome (RTT) gene. M6b, a member of the proteolipid protein gene family, was mapped to Xp22.2 within one of the RTT candidate regions. In this article we describe
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica