Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

HPA000764

Sigma-Aldrich

Anti-KLK3 antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-γ-Seminoprotein antibody produced in rabbit, Anti-Kallikrein-3 antibody produced in rabbit, Anti-P-30 antigen antibody produced in rabbit, Anti-PSA antibody produced in rabbit, Anti-Prostate-specific antigen precursor antibody produced in rabbit, Anti-Semenogelase antibody produced in rabbit, Anti-Seminin antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Número MDL:
MFCD08705469
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA000764
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:2500- 1:5000

sequência de imunogênio

SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA

nº de adesão UniProt

P07288

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... KLK3(354)

Procurando produtos similares? Visita Guia de comparação de produtos

Categorias relacionadas

Imunogênio

Prostate-specific antigen precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-KLK3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

Prostate-specific antigen (PSA or γ-seminoprotein or kallikrein-3 (KLK3)) is a glycoprotein enzyme encoded by the KLK3 gene in humans and belongs to tissue kallikrein family. It is an androgen-regulated serine protease produced by both prostate epithelial cells and prostate cancer cells(PCa). PSA is secreted into prostatic ducts (as an inactive 244-amino acid proenzyme (proPSA) that gets activated by cleavage of seven N-terminal amino acids). It is a major protein in semen and functions to cleave semenogelins in the seminal coagulum. PSA may have a role in pathogenesis of PCa. It acts as a useful biomarker of prostate cancer (PCa).

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST79755

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
B74856
R00264
R000264

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Atsushi Okato et al.
International journal of oncology, 49(1), 111-122 (2016-05-24)
Advanced prostate cancer (PCa) metastasizes to bone and lymph nodes, and currently available treatments cannot prevent the progression and metastasis of the disease. Therefore, an improved understanding of the molecular mechanisms of the progression and metastasis of advanced PCa using
Takayuki Arai et al.
International journal of urology : official journal of the Japanese Urological Association, 26(4), 506-520 (2019-03-01)
To identify oncogenes regulated by micro-ribonucleic acid, miR-199a/b-3p, in metastatic castration-resistant prostate cancer. Advanced ribonucleic acid sequencing technologies were applied to construct a micro-ribonucleic acid expression signature using metastatic castration-resistant prostate cancer autopsy specimens. Ectopic expression of mature micro-ribonucleic acids
H Liu et al.
Cell death & disease, 4, e857-e857 (2013-10-19)
Cancer stem cells (CSCs) are believed to be a promising target for cancer therapy because these cells are responsible for tumor development, maintenance and chemotherapy resistance. Finding out the critical factors regulating CSC fate is the key for target therapy
Yusuke Goto et al.
British journal of cancer, 113(7), 1055-1065 (2015-09-02)
Our present study of the microRNA (miRNA) expression signature in castration-resistant prostate cancer (CRPC) revealed that the clustered miRNAs microRNA-221 (miR-221) and microRNA-222 (miR-222) are significantly downregulated in cancer tissues. The aim of this study was to investigate the functional
Kouji Izumi et al.
Journal of cancer research and clinical oncology, 140(8), 1413-1419 (2014-04-22)
Prostate-specific antigen (PSA) is a useful biomarker of prostate cancer (PCa). High-risk localized PCa is defined using T stage, Gleason score (GS), and PSA. However, PSA level defining high-risk PCa is at most 20 ng/mL. In PCa patients with high
Exibir todos os documentos relacionados

Global Trade Item Number

SKUGTIN
HPA000764-25UL4061842765133
HPA000764-100UL4061836317881

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica