Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

AV54780

Sigma-Aldrich

Anti-LOXL1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-LOL, Anti-LOXL, Anti-Lysyl oxidase-like 1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

63 kDa

reatividade de espécies

guinea pig, mouse, rat, human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_005567

nº de adesão UniProt

Q08397

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... LOXL1(4016)

Imunogênio

Synthetic peptide directed towards the N terminal region of human LOXL1

Aplicação

Anti-LOXL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Ações bioquímicas/fisiológicas

The encoded protein belongs to lysyl oxidase gene family and is mapped on to chromosome 15 at 15q24-q25. It is an extracellular protein with elastin and collagen as the chief substrates. It plays a crucial role in oxidizing the epsilon (ε) amino group in lysine to produce an aldehyde group. Lysyl oxidases are copper amine oxidases that facilitate the biogenesis of connective tissue by initiating the covalent crosslinking between collagens and elastin. Defect in LOXL1 gene expression is associated with exfoliation disease development.

Sequência

Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ane Iturbide et al.
The FEBS journal, 282(9), 1768-1773 (2014-08-12)
The lysyl oxidase (LOX) family of proteins (LOX and LOXL1-LOXL4) oxidize amino groups located in the ε-position in lysines to generate an aldehyde group. In general, they are considered as extracellular proteins and have elastin and collagen as their main
Janey L Wiggs et al.
Journal of glaucoma, 23(8 Suppl 1), S62-S63 (2014-10-03)
Variants in LOXL1 are significantly associated with exfoliation syndrome (XFS), however the impact of the associated variants on disease development is not yet understood. Initially the associated missense changes, R141L and G153D, were considered to be pathogenic alleles. Flipping of
K Kenyon et al.
The Journal of biological chemistry, 268(25), 18435-18437 (1993-09-05)
A novel human cDNA with a predicted protein homologous to the carboxyl end of lysyl oxidase, an extracellular enzyme involved in the maturation of collagen and elastin, has been isolated. The homology to lysyl oxidase begins exactly at the position
T Tadmor et al.
American journal of hematology, 88(5), 355-358 (2013-03-16)
Myeloproliferative neoplasms (MPNs) are malignant disorders originating from clonal expansion of a single neoplastic stem cell and characteristically show an increase in bone marrow reticulin fibers. Lysyl oxidases (LOXs) are copper-dependent amine oxidases that play a critical role in the

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica