Pular para o conteúdo
Merck
Todas as fotos(3)

Key Documents

AV54299

Sigma-Aldrich

Anti-GSN antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-DKFZp313L0718, Anti-Gelsolin (aMyloidosis, Finnish type)

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

83 kDa

reatividade de espécies

bovine, sheep, horse, guinea pig, human, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GSN(2934)

Imunogênio

Synthetic peptide directed towards the C terminal region of human GSN

Aplicação

Anti-GSN antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Ações bioquímicas/fisiológicas

GSN gene encodes a 93,000-dalton actin-modulating protein localized in the cytoplasm of cells. It plays a pivotal role in regulating actin filament length as well as prevents monomer exchange by blocking or capping the "plus" ends of actin monomers and filaments. Defects in GSN gene leads to familial amyloidosis Finnish type (FAF).

Sequência

Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

D J Kwiatkowski et al.
Nature, 323(6087), 455-458 (1986-10-02)
Gelsolin is representative of a class of actin-modulating proteins found in lower eukaryotes to mammals, which sever actin filaments. Gelsolin found in the cytoplasm of cells is functionally similar to a mammalian plasma protein of similar size, originally called ADF
A de la Chapelle et al.
Nature genetics, 2(2), 157-160 (1992-10-01)
Dominantly inherited familial amyloidosis, Finnish type (FAF) is caused by the accumulation of a 71-amino acid amyloidogenic fragment of mutant gelsolin (GSN). FAF is common in Finland but is very rare elsewhere. In Finland and in two American families, the
D Wen et al.
Biochemistry, 35(30), 9700-9709 (1996-07-30)
Gelsolin is a widely distributed actin binding protein that regulates actin filament length. It exists in both an intracellular and an extracellular form that is derived from a single gene by alternative splicing. Both forms contain the six homologous domains

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica