AV52288

Anti-NUP50 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-MGC39961, Anti-NPAP60, Anti-NPAP60L, Anti-Nucleoporin 50 kDa
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: IF; WB
• clone: polyclonal
• reatividade de espécies: pig, rabbit, dog, horse, human, bovine
• técnica(s): immunofluorescence: suitable; western blot: suitable

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 50 kDa
• reatividade de espécies: pig, rabbit, dog, horse, human, bovine
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunofluorescence: suitable; western blot: suitable
• nº de adesão NCBI: NP_705931
• nº de adesão UniProt: Q9UKX7
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NUP50(10762)

Descrição

Imunogênio

Synthetic peptide directed towards the C terminal region of human NUP50

Ações bioquímicas/fisiológicas

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.

Sequência

Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable