Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV51270

Sigma-Aldrich

Anti-TNNI2 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-AMCD2B, Anti-DA2B, Anti-FSSV, Anti-Troponin I type 2 (skeletal, fast)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

21 kDa

reatividade de espécies

bovine, dog, horse, guinea pig, human, rat, rabbit, goat

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_003273

nº de adesão UniProt

P48788

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TNNI2(7136)

Imunogênio

Synthetic peptide directed towards the N terminal region of human TNNI2

Aplicação

Anti-TNNI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Ações bioquímicas/fisiológicas

Troponin I type 2 (TNNI2) is a fast-twitch muscle protein belonging to the troponin I gene family. It forms a complex that regulates striated muscle contraction along with troponins T and C. TNNI2 also has a role in smooth muscle contraction, angiogenesis, metastasis and tumor growth. Mutations in TNNI2 gene have been implicated in myopathy1 and distal arthrogryposis type 2B.

Sequência

Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

E Kimber et al.
Neurology, 67(4), 597-601 (2006-08-23)
To describe a three-generation family with distal arthrogryposis associated with myopathy and caused by a mutation in the gene encoding for sarcomeric thin filament protein troponin I, TNNI2. The authors performed clinical investigations and reviewed medical records. Muscle biopsy specimens
Miao Jiang et al.
Human genetics, 120(2), 238-242 (2006-06-28)
Distal arthrogryposis (DA) is composed of a group of clinically and genetically heterogeneous disorders, characterized by multiple congenital contractures of the limbs. Point mutations in three genes encoding contractile fast-twitch myofibers, TPM2, TNNI2 and TNNT3, were recently identified in DA
GuangWu Xiong et al.
Science in China. Series C, Life sciences, 50(1), 93-100 (2007-03-30)
To explore the efficiency and mechanism of ovarian carcinoma gene therapy with the human fast-twitch skeletal muscle troponin I gene (Tnl-fast), Tnl-fast cDNA was transferred into human ovarian adenocarcinoma cell-line SK-OV-3. In vitro, the cell growth and cell cycle of

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica