Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV50258

Sigma-Aldrich

Anti-B3GALT6 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-β3GalT6, Anti-UDP-Gal:βGal β 1,3-galactosyltransferase polypeptide 6

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

37 kDa

reatividade de espécies

human, rat, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_542172

nº de adesão UniProt

Q96L58

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... B3GALT6(126792)

Imunogênio

Synthetic peptide directed towards the N terminal region of human B3GALT6

Aplicação

Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Ações bioquímicas/fisiológicas

UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 (B3GALT6; EDSP2; SEMDJL1) catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal β-linked galactose moiety. It is localized to Golgi apparatus and is required for glycosaminoglycan synthesis. Aberrations in B3GALT6 gene result in skeletal and connective tissue disorders, collectively known as Ehlers-Danlos syndrome.

Sequência

Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC20525

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Fransiska Malfait et al.
American journal of human genetics, 92(6), 935-945 (2013-05-15)
Proteoglycans are important components of cell plasma membranes and extracellular matrices of connective tissues. They consist of glycosaminoglycan chains attached to a core protein via a tetrasaccharide linkage, whereby the addition of the third residue is catalyzed by galactosyltransferase II
Masahiro Nakajima et al.
American journal of human genetics, 92(6), 927-934 (2013-05-15)
Proteoglycans (PGs) are a major component of the extracellular matrix in many tissues and function as structural and regulatory molecules. PGs are composed of core proteins and glycosaminoglycan (GAG) side chains. The biosynthesis of GAGs starts with the linker region
X Bai et al.
The Journal of biological chemistry, 276(51), 48189-48195 (2001-09-12)
A family of five beta1,3-galactosyltransferases has been characterized that catalyze the formation of Galbeta1,3GlcNAcbeta and Galbeta1,3GalNAcbeta linkages present in glycoproteins and glycolipids (beta3GalT1, -2, -3, -4, and -5). We now report a new member of the family (beta3GalT6), involved in

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica