Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

AV49134

Sigma-Aldrich

Anti-SULT1A1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-HAST1/HAST2, Anti-MGC131921, Anti-MGC5163, Anti-P-PST, Anti-PST, Anti-ST1A3, Anti-STP, Anti-Sulfotransferase family, cytosolic, 1A, phenol-preferRing, member 1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

34 kDa

reatividade de espécies

human, horse, rabbit, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_001046

nº de adesão UniProt

P50226

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SULT1A1(6817)

Imunogênio

Synthetic peptide directed towards the N terminal region of human SULT1A1

Aplicação

Anti-SULT1A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1) is a phenol sulfotransferase with thermostable activity. The members of sulfotransferase family localize to cytoplasm and catalyze the sulfate conjugation of hormones, xenobiotic compounds, drugs and neurotransmitters.

Sequência

Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC20645

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

M W H Coughtrie
The pharmacogenomics journal, 2(5), 297-308 (2002-11-20)
Members of the cytosolic sulfotransferase (SULT) superfamily catalyse the sulfation of a multitude of xenobiotics, hormones and neurotransmitters. Humans have at least 10 functional SULT genes, and a number of recent advances reviewed here have furthered our understanding of SULT
Philip M Probert et al.
Toxicology letters, 243, 98-110 (2016-01-08)
Rat B-13 progenitor cells are readily converted into functional hepatocyte-like B-13/H cells capable of phase I cytochrome P450-dependent activation of pro-carcinogens and induction of DNA damage. The aim of the present study was to investigate whether the cells are also
S J Hebbring et al.
Cytogenetic and genome research, 123(1-4), 205-210 (2008-01-01)
Pharmacogenetics is the study of the role of inheritance in variation to drug response. Drug response phenotypes can vary from adverse drug reactions at one end of the spectrum to equally serious lack of the desired effect of drug therapy

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica