Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

AV47093

Sigma-Aldrich

Anti-SV2A antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-KIAA0736, Anti-SV2, Anti-Synaptic vesicle glycoprotein 2A

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

peso molecular

83 kDa

reatividade de espécies

human, guinea pig, mouse, bovine, horse, dog, rabbit, rat

embalagem

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_055664

nº de adesão UniProt

Q7L0J3

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SV2A(9900)

Imunogênio

Synthetic peptide directed towards the middle region of human SV2A

Aplicação

Anti-SV2A antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Ações bioquímicas/fisiológicas

SV2A (synaptic vesicle glycoprotein 2A) gene is a multi-pass membrane protein that belongs to major facilitator superfamily. It regulates the cytoplasmic Ca2+ levels in the nerve terminal during repetitive stimulation and facilitates the synaptic transmission. SV2A serves as a binding site for the antiepileptic drug levetiracetam and may decrease the neuronal excitability. Mutation in SV2A gene results in schizophrenia.

Sequência

Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

recomendado

Nº do produto
Descrição
Preços

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC17148

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Marjolein de Groot et al.
Neuro-oncology, 12(3), 265-273 (2010-02-20)
Synaptic vesicle protein 2A (SV2A) has been identified as the binding site for the antiepileptic drug levetiracetam and is thought to decrease neuronal excitability. Since knockout of SV2A in mice leads to seizures, we hypothesized that a reduction in SV2A
Manuel Mattheisen et al.
Schizophrenia research, 141(2-3), 262-265 (2012-09-29)
Convergent evidence from pharmacological and animal studies suggests a possible role for the synaptic vesicle glycoprotein 2A gene (SV2A) in schizophrenia susceptibility. To test systematically all common variants in the SV2A gene region for an association with schizophrenia, we used
R Janz et al.
Neuron, 24(4), 1003-1016 (2000-01-07)
SV2 proteins are abundant synaptic vesicle proteins expressed in two major (SV2A and SV2B) and one minor isoform (SV2C) that resemble transporter proteins. We now show that SV2B knockout mice are phenotypically normal while SV2A- and SV2A/SV2B double knockout mice
Gary W Lawrence et al.
The FEBS journal, 281(14), 3243-3260 (2014-05-28)
Sympathetic neurons ramify to innervate multiple cells in target tissues. In compartmentalized cultures of rat superior cervical ganglion neurons, cleavage of synaptosomal-associated protein of Mr  = 25 000 (SNAP-25) in neurites exposed to botulinum neurotoxin type A (BoNT/A) arrested their growth and collapsed
Juan A Araya et al.
Journal of Alzheimer's disease : JAD, 42(1), 143-155 (2014-05-16)
Alzheimer's disease (AD) is a progressive and neurodegenerative disorder and one of the current therapies involves strengthening the cholinergic tone in central synapses. Neuroprotective properties for nicotine have been described in AD, through its actions on nicotinic receptors and the
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica