Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV47083

Sigma-Aldrich

Anti-KIAA0319 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-DLX2, Anti-DYLX2, Anti-DYX2, Anti-KIAA0319, Anti-MGC176717

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

56 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_055624

nº de adesão UniProt

Q5VV43

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... KIAA0319(9856)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the N terminal region of human KIAA0319

Aplicação

Anti-KIAA0319 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Ações bioquímicas/fisiológicas

KIAA0319 gene encodes a single-pass type I membrane protein primarily expressed in brain cortex, putamen, amygdala, hippocampus and cerebellum. It plays a crucial role in regulating neuronal migration and cell adhesion and hence facilitates the development of cerebral cortex. KIAA0319 may also regulate the growth and differentiation of dendrites.

Sequência

Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC17140

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Silvia Paracchini et al.
Human molecular genetics, 15(10), 1659-1666 (2006-04-08)
Dyslexia is one of the most prevalent childhood cognitive disorders, affecting approximately 5% of school-age children. We have recently identified a risk haplotype associated with dyslexia on chromosome 6p22.2 which spans the TTRAP gene and portions of THEM2 and KIAA0319.
Veronica J Peschansky et al.
Cerebral cortex (New York, N.Y. : 1991), 20(4), 884-897 (2009-08-15)
We investigated the postnatal effects of embryonic knockdown and overexpression of the candidate dyslexia gene homolog Kiaa0319. We used in utero electroporation to transfect cells in E15/16 rat neocortical ventricular zone with either 1) small hairpin RNA (shRNA) vectors targeting

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica