Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV45622

Sigma-Aldrich

Anti-RORC (AB2) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-MGC129539, Anti-NR1F3, Anti-RAR-related orphan receptor C, Anti-RORG, Anti-RZRG, Anti-TOR

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

56 kDa

reatividade de espécies

guinea pig, horse, human, rat, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_005051

nº de adesão UniProt

P51449

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... RORC(6097)

Descrição geral

The previously assigned protein identifier Q5SZR9 has been merged into P51449. Full details can be found on the UniProt database.

Imunogênio

Synthetic peptide directed towards the N terminal region of human RORC

Aplicação

Anti-RORC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Ações bioquímicas/fisiológicas

Retinoic acid related orphan receptor C (RORC), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORs have important roles in development, immunity and maintenance of circadian rhythm and metabolism. RORC may be involved in lymphoid organogenesis and thymopoiesis.

Sequência

Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC22981

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Anton M Jetten
Nuclear receptor signaling, 7, e003-e003 (2009-04-22)
The last few years have witnessed a rapid increase in our knowledge of the retinoid-related orphan receptors RORalpha, -beta, and -gamma (NR1F1-3), their mechanism of action, physiological functions, and their potential role in several pathologies. The characterization of ROR-deficient mice
Ivan Dzhagalov et al.
Cellular & molecular immunology, 1(6), 401-407 (2005-11-19)
Hormones and their receptors regulate cell growth, differentiation and apoptosis and also play important roles in immune function. Recent studies on the subfamily of the orphan nuclear receptors known as retinoid-acid related orphan receptors (ROR) have shed important insights on
Shoki Sato et al.
Oncology reports, 32(6), 2753-2759 (2014-10-14)
The disease frequency of pancreatic neuroendocrine tumors (PNETs) has been growing, and postoperative hepatic recurrence (PHR) is one of the factors affecting patient prognosis. The present study aimed to investigate biomarkers of PNETs in the primary disease site to predict
Matthew B Carlin et al.
The Journal of nutrition, 144(9), 1409-1414 (2014-07-25)
Essential amino acids (EAAs) are potent stimulators of mechanistic target of rapamycin complex 1 (mTORC1) signaling and muscle protein synthesis. However, regulators upstream of mTORC1 that are responsive to EAA availability are not well described, especially in human skeletal muscle.
Zhen He et al.
Oncology reports, 32(5), 1873-1880 (2014-09-02)
Chronic inflammation is an underlying risk factor for colorectal cancer. No direct evidence has proven that inflammation in the colon promotes carcinogenesis. STAT3 plays an important role in the development of colitis-associated colorectal cancer (CAC). There is crosstalk between the
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica