Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV45602

Sigma-Aldrich

Anti-ESRRG antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-DKFZp781L1617, Anti-ERR3, Anti-Estrogen-related receptor γ, Anti-FLJ16023, Anti-KIAA0832, Anti-NR3B3

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

51 kDa

reatividade de espécies

guinea pig, horse, rat, human, bovine, dog, rabbit, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_001127757

nº de adesão UniProt

P62508

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ESRRG(2104)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the N terminal region of human ESRRG

Aplicação

Anti-ESRRG antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Ações bioquímicas/fisiológicas

Estrogen-related receptor gamma (ESRRG) is an orphan nuclear receptor that belongs to the estrogen receptor-related receptor family. ESRR family members have the same set of target genes and regulators as the estrogen receptors. ESRRG acts as a transcriptional activator of DNA cytosine-5-methyltransferases 1 and modulates cell proliferation, osteoblast differentiation and bone formation and energy metabolism in human trophoblasts. Studies indicate that this receptor mediates antidiabetic effect as it inhibits hepatic gluconeogenesis.

Sequência

Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC21780

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Don-Kyu Kim et al.
Diabetes, 62(9), 3093-3102 (2013-06-19)
Type 2 diabetes mellitus (T2DM) is a progressive metabolic disorder with diverse pathological manifestations and is often associated with abnormal regulation of hepatic glucose production. Many nuclear receptors known to control the hepatic gluconeogenic program are potential targets for the
Byung-Chul Jeong et al.
The Journal of biological chemistry, 284(21), 14211-14218 (2009-03-28)
Estrogen receptor-related receptor gamma (ERRgamma/ERR3/NR3B3) is a member of the orphan nuclear receptor with important functions in development and homeostasis. Recently it has been reported that ERRalpha is involved in osteoblast differentiation and bone formation. In the present study we
D Poidatz et al.
Placenta, 33(9), 688-695 (2012-07-06)
Placenta growth and functions depend on correct trophoblast migration, proliferation, and differentiation. The placenta has a critical role in gas and nutrient transport. To accomplish these numerous functions, the placenta depends on a highly efficient energy metabolism control. Recent studies

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica