Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

AV31655

Sigma-Aldrich

Anti-ESRRG antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-Estrogen-related receptor γ

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

51 kDa

reatividade de espécies

human, rabbit, dog, guinea pig, horse, mouse, bovine, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ESRRG(2104)

Categorias relacionadas

Descrição geral

ESRRG (or ERRgamma) is a transcriptional activator of Dnmt1 expression in humans and mice. This transcription factor has also been implicated in renal papilla development, as well as in lipid and lipoprotein metabolism.
Rabbit ESRRG antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and chicken ESRRG.

Imunogênio

Synthetic peptide directed towards the middle region of human ESRRG

Aplicação

Rabbit ESRRG antibody has been used for co-immunoprecipitation and western blot assays. Sigma has verified the use of the product in western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissue sections) applications.

Ações bioquímicas/fisiológicas

ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Sequência

Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

D Sanoudou et al.
The pharmacogenomics journal, 10(3), 165-179 (2009-12-02)
We have used a new ApoA-I transgenic mouse model to identify by global gene expression profiling, candidate genes that affect lipid and lipoprotein metabolism in response to fenofibrate treatment. Multilevel bioinformatical analysis and stringent selection criteria (2-fold change, 0% false
Yuxia Zhang et al.
FEBS letters, 585(9), 1269-1275 (2011-04-05)
We describe a transcriptional mechanism regulating the expression of Dnmt1 by nuclear receptors. We show that ERRγ functions as a transcriptional activator of mouse and human Dnmt1 expression by direct binding to its response elements (ERE1/ERE2) in the dnmt1/DNMT1 promoters.
Rachel Berry et al.
Human molecular genetics, 20(5), 917-926 (2010-12-09)
Congenital anomalies of the kidney and urinary tract (CAKUTs) are common disorders of human development affecting the renal parechyma, renal pelvis, ureter, bladder and urethra; they show evidence of shared genetic aetiology, although the molecular basis of this remains unknown

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica