Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV44434

Sigma-Aldrich

Anti-FMO3 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-FMOII, Anti-Flavin containing monooxygenase 3, Anti-MGC34400, Anti-dJ127D3.1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

59 kDa

reatividade de espécies

bovine, rat, human, pig, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_001002294

nº de adesão UniProt

P31513

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... FMO3(2328)

Imunogênio

Synthetic peptide directed towards the N terminal region of human FMO3

Aplicação

Anti- FMO3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Ações bioquímicas/fisiológicas

FMO3 belongs to the Flavin-containing monooxygenases (FMO) family of drug-metabolizing enzymes that catalyze the oxidation of various xenobiotics. FMO3 is a transmembrane protein present in the endoplasmic reticulum. Mutations in gene encoding FMO3 causes trimethylaminuria or fish odor syndrome.

Sequência

Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC14345

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Filipa Ferreira et al.
Gene, 527(1), 366-370 (2013-06-25)
Trimethylaminuria (TMAu) or "fish odor syndrome" is a metabolic disorder characterized by the inability to convert malodorous dietarily-derived trimethylamine (TMA) to odorless TMA N-oxide by the flavin-containing monooxygenase 3 (FMO3). Affected individuals unable to complete this reaction exude a "fishy"
Catherine A Ulman et al.
Dermatology online journal, 20(1), 21260-21260 (2014-01-25)
Trimethylaminuria is a rare, autosomal recessive, metabolic disorder that results in accumulation of trimethylamine (TMA), which smells like rotten fish. The chemical is excreted in sweat and urine owing to a deficiency in the enzyme flavin monooxygenase 3 (FMO3). We
Hiroshi Yamazaki et al.
Biochemical pharmacology, 85(11), 1588-1593 (2013-04-10)
Human flavin-containing monooxygenase 3 (FMO3, EC 1.14.13.8) in liver catalyzes a variety of oxygenations of nitrogen- and sulfur-containing medicines and xenobiotic substances. Loss-of-function mutations of the FMO3 gene, the enzyme responsible for trimethylamine N-oxygenation, cause the inherited disorder trimethylaminuria (also

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica