AV43962

Anti-SLC25A39 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-CGI-69, Anti-CGI69, Anti-FLJ22407, Anti-Solute carrier family 25, member 39
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 39 kDa
• reatividade de espécies: human, horse, rat, mouse, guinea pig, rabbit, bovine, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_001137252
• nº de adesão UniProt: Q9BZJ4-2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SLC25A39(51629)

Descrição

Descrição geral

Solute carrier family 25, member 39 (SLC25A39, CGI69) is a member of the SLC25 carrier family that mediates transport across the inner mitochondrial membrane. SLC25A39 may be involve in the incorporation of iron into protoporphyrin IX, an essential step in heme biosynthesis.

Especificidade

Anti-SLC25A39 polyclonal antibody reacts with human, mouse, rat, canine, bovine, and zebrafish solute carrier family 25, member 39 proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human SLC25A39

Aplicação

Anti-SLC25A39 polyclonal antibody is used to tag solute carrier family 25, member 39 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 25, member 39 in mitochondrial transport in support of iron-dependent processes such as heme biosynthesis.

Ações bioquímicas/fisiológicas

SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Sequência

Synthetic peptide located within the following region: RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable