Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV43930

Sigma-Aldrich

Anti-SLC7A8 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-LAT2, Anti-LPI-PC1, Anti-Solute carrier family 7 (cationic amino acid transporter, y+ system), member 8

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

37 kDa

reatividade de espécies

guinea pig, human, mouse, rat, bovine, rabbit, horse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_036376

nº de adesão UniProt

Q9UHI5-2

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SLC7A8(23428)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the middle region of human SLC7A8

Aplicação

Anti-SLC7A8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Ações bioquímicas/fisiológicas

SLC7A8 also referred to as LAT2 is an L-type neutral amino acid transporter present in the epithelium of kidney proximal tubules and the digestive tract. LAT2 preferentially selects branched-chain amino acids as substrates and transports them across membranes. It has been reported that LAT2 activates the pathway mediated by mammalian target of rapamycin complex 1 (mTORC1) in the glomerular epithelial cells and has a role in the pathogenesis of crescentic glomerulonephritis.

Sequência

Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC17590

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Jonas Zaugg et al.
Journal of cellular and molecular medicine, 24(21), 12681-12693 (2020-10-02)
The placenta supplies the foetus with critical nutrients such as essential amino acids (AA, eg leucine) for development and growth. It also represents a cellular barrier which is formed by a polarized, differentiated syncytiotrophoblast (STB) monolayer. Active Na+ -independent leucine
Caroline Moret et al.
American journal of physiology. Renal physiology, 292(2), F555-F566 (2006-09-28)
The kidney plays a major role in acid-base homeostasis by adapting the excretion of acid equivalents to dietary intake and metabolism. Urinary acid excretion is mediated by the secretion of protons and titratable acids, particularly ammonia. NH(3) is synthesized in
Ryota Kurayama et al.
Laboratory investigation; a journal of technical methods and pathology, 91(7), 992-1006 (2011-03-16)
Molecular mechanisms and signaling pathways leading to cellular proliferation and lesion formation in the crescentic glomerulonephritis (CGN) remain elusive. In the present study we have explored a potential role of the mammalian target of rapamycin complex 1 (mTORC1) signaling pathway
Sun Young Park et al.
Archives of pharmacal research, 28(4), 421-432 (2005-05-28)
In order to understand the renal reabsorption mechanism of neutral amino acids via amino acid transporters, we have isolated human L-type amino acid transporter 2 (hLAT2) and human T-type amino acid transporter 1 (hTAT1) in human, then, we have examined

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica