AV41787
Anti-ADH1B antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-ADH2, Anti-Alcohol dehydrogenase IB (class I), β polypeptide
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
41 kDa
reatividade de espécies
human
concentração
0.5 mg - 1 mg/mL
técnica(s)
immunohistochemistry: suitable
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... ADH1B(125)
Descrição geral
Alcohol dehydrogenase-1B (ADH2) is an enzyme that metabolized a variety of substrates including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Alcohol dehydrogenase-1B is important in studies on alcoholism.
Especificidade
Anti-alcohol dehydrogenase-1B (ADH2) reacts with the β-polypeptide of human alcohol dehydrogenase-1B.
Imunogênio
Synthetic peptide directed towards the C terminal region of human ADH1B
Aplicação
Anti-alcohol dehydrogenase-1B (ADH2) polyclonal antibody is used to tag alcohol dehydrogenase-1B protein(s)/subunits for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.
Ações bioquímicas/fisiológicas
ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.
Sequência
Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Kshipra M Gharpure et al.
Oncotarget, 9(38), 25115-25126 (2018-06-05)
Primary debulking surgery followed by adjuvant chemotherapy is the standard treatment for ovarian cancer. Residual disease after primary surgery is associated with poor patient outcome. Previously, we discovered ADH1B to be a molecular biomarker of residual disease. In the current
Hui Li et al.
Toxicological sciences : an official journal of the Society of Toxicology, 164(2), 428-438 (2018-05-03)
Alcohol metabolism is a well-characterized biological process that is dominated by the alcohol dehydrogenase (ADH) and aldehyde dehydrogenase (ALDH) families. Nonalcoholic steatohepatitis (NASH) is the advanced inflammatory stage of nonalcoholic fatty liver disease (NAFLD) and is known to alter the
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica