Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV41591

Sigma-Aldrich

Anti-VSIG4 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-V-set and immunoglobulin domain containing 4, Anti-Z39IG

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

44 kDa

reatividade de espécies

pig, human, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... VSIG4(11326)

Categorias relacionadas

Descrição geral

Adaptive immune response involving activated lymphocytes requires the engagement of T-cell receptors by antigenic peptide-MHC complexes (APC). B7 family members are involved in the regulation of T-cell activation by APCs. V-set and immunoglobulin domain containing 4 (VSIG4, Z39IG), a B7 family-related protein, has been identified as a negative regulator of T-cell activation. VSIG4 may play a role in inhibiting processes such as interstitial fibrosis.

Especificidade

Anti-VSIG4 polyclonal antibody reacts with bovine, human, mouse, and rat V-set and immunoglobulin domain containing 4 proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human VSIG4

Aplicação

Anti-VSIG4 polyclonal antibody is used to tag V-set and immunoglobulin domain containing 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of V-set and immunoglobulin domain containing 4 as a negative regulator of T-cell activation during adaptive immune response.

Ações bioquímicas/fisiológicas

T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Sequência

Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Qian Qiao et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 28(11), 4986-4999 (2014-08-13)
The inappropriate activation of complement may contribute to various immune diseases. The alternative pathway (AP) predominates during complement activation regardless of the initiating pathways. Hence, the main AP regulator factor H (FH) holds great potential as an attractive therapeutic intervention.
Yunmei Liao et al.
Laboratory investigation; a journal of technical methods and pathology, 94(7), 706-715 (2014-05-28)
Tumor-associated macrophages are a prominent component of lung cancer stroma and contribute to tumor progression. The protein V-set and Ig domain-containing 4 (VSIG4), a novel B7 family-related macrophage protein that has the capacity to inhibit T-cell activation, has a potential

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica