AV41490
Anti-FN1 antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Fn1 Antibody, Fn1 Antibody - Anti-FN1 antibody produced in rabbit, Anti-CIG, Anti-DKFZp686F10164, Anti-DKFZp686H0342, Anti-DKFZp686I1370, Anti-DKFZp686O13149, Anti-FINC, Anti-FN, Anti-Fibronectin 1
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
76 kDa
reatividade de espécies
bovine, dog, sheep, pig, human
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... FN1(2335)
Descrição geral
Fibronectins are a class of immunochemically related glycoproteins present in basement membranes, collective tissues and blood wherein they mediate adhesion between matrix components and cells. Plasma fibronectin (CLG) mediates the attachment of monocytes (fibroblasts, macrophages) to various cell matrices and materials such as gelatin.
Especificidade
Anti-FN1 polyclonal antibody reacts with human, canine, rabbit, bovine, rat, and mouse plasma fibronectin (CIG).
Imunogênio
Synthetic peptide directed towards the C terminal region of human FN1
Aplicação
Anti-FN1 polyclonal antibody is used to tag plasma fibronectin (CIG) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of fibronectin (CIG) in the adherence of monocytes to cell matricies and solid surfaces coated with materials such as gelatin.
Ações bioquímicas/fisiológicas
FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.
Sequência
Synthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Guiqin Song et al.
Oncotarget, 8(11), 17771-17784 (2017-02-02)
Esophageal cancer is a highly aggressive malignancy with very poor overall prognosis. Given the strong clinical relevance of SATB1 in esophagus cancer and other cancers suggested by previous studies, the exact function of SATB1 in esophagus cancer development is still
Saidou Balam et al.
Journal of immunology (Baltimore, Md. : 1950), 202(12), 3514-3523 (2019-05-10)
Chronic rejection is a major problem in transplantation medicine, largely resistant to therapy, and poorly understood. We have shown previously that basophil-derived IL-4 contributes to fibrosis and vasculopathy in a model of heart transplantation with depletion of CD4+ T cells.
Donor-But Not Recipient-Derived Cells Produce Collagen-1 in Chronically Rejected Cardiac Allografts.
Saidou Balam et al.
Frontiers in immunology, 12, 816509-816509 (2022-02-08)
Fibrosis is a prominent feature of chronic allograft rejection, caused by an excessive production of matrix proteins, including collagen-1. Several cell types produce collagen-1, including mesenchymal fibroblasts and cells of hematopoietic origin. Here, we sought to determine whether tissue-resident donor-derived
Xianghui Chen et al.
Kidney international, 95(4), 880-895 (2019-02-23)
Ectopic fat deposition (EFD) in the kidney has been shown to play a causal role in diabetic nephropathy; however, the mechanism underlying EFD remains elusive. By transcriptome analysis, we found decreased expression levels of disulfide-bond A oxidoreductase-like protein (DsbA-L) in
Yan Wang et al.
International journal of molecular medicine, 35(4), 1067-1073 (2015-02-13)
Fucoidan, an extract of the seaweed, Fucus vesiculosus, has been widely investigated for its antioxidant effects. However, to date and to the best of our knowledge, pathological studies on the effects of fucoidan against diabetic nephropathy (DN) related to spontaneous
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica