AV39663

Anti-MXD3 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-MAD3, Anti-MAX dimerization protein 3, Anti-MGC2383
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 23 kDa
• reatividade de espécies: horse, mouse, guinea pig, bovine, rat, human, rabbit, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_112590
• nº de adesão UniProt: Q9BW11
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MXD3(83463)

Descrição

Descrição geral

MXD3 is a basic, helix-loop-helix transcription factor that belongs to the MAD family of proteins. This protein is involved in cerebellar development and GNP proliferation. Studies have reported that MXD3 is also required for the proliferation of DAOY medulloblastoma cells.
Rabbit Anti-MXD3 antibody binds to chicken, human, mouse, rat, bovine, zebrafish, and canine MXD3.

Imunogênio

Synthetic peptide directed towards the N terminal region of human MXD3

Aplicação

Rabbit Anti-MXD3 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5′-CAC[GA]TG-3′. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.

Sequência

Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable