Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV35263

Sigma-Aldrich

Anti-CLIC5 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Chloride intracellular channel 5

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

28 kDa

reatividade de espécies

rat, horse, bovine, human, guinea pig, rabbit

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CLIC5(53405)

Descrição geral

CLIC5 is a chloride intracellular channel protein involved in hair cell stereocilia formation. It reportedly stabilizes membrane-actin filament links at the base of stereocilia. It has a role in the growth and differentiation of C2C12 myoblasts.
Rabbit Anti-CLIC5 antibody recognizes human, mouse, rat, pig, zebrafish, chicken, canine, and bovine CLIC5.

Imunogênio

Synthetic peptide directed towards the C terminal region of human CLIC5

Aplicação

Rabbit Anti-CLIC5 antibody is suitable for western blot (0.25 μg/ml) and IHC (4-8 μg/ml) applications.

Ações bioquímicas/fisiológicas

Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Sequência

Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Fengna Li et al.
Cell biology international, 34(4), 379-384 (2010-01-09)
CLIC5 (chloride intracellular channel 5) is a CLIC (chloride intracellular channel) with various functions. Its high expression in skeletal muscle and association with actin-based cytoskeleton suggests that it may play an important role in muscle tissue. This study was conducted
Felipe T Salles et al.
Cytoskeleton (Hoboken, N.J.), 71(1), 61-78 (2013-11-29)
Chloride intracellular channel 5 protein (CLIC5) was originally isolated from microvilli in complex with actin binding proteins including ezrin, a member of the Ezrin-Radixin-Moesin (ERM) family of membrane-cytoskeletal linkers. CLIC5 concentrates at the base of hair cell stereocilia and is

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica