Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV34484

Sigma-Aldrich

Anti-SMARCA2 antibody produced in rabbit

affinity isolated antibody

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

32 kDa

reatividade de espécies

mouse, rabbit, horse, bovine, human, dog, guinea pig, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SMARCA2(6595)

Categorias relacionadas

Descrição geral

SWItch/Sucrose Non-Fermentable (SWI/SNF)-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 (SMARCA2) is a member of the SWI/SNF family of proteins and is highly like the Brahma protein of Drosophila. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.

Imunogênio

Synthetic peptide directed towards the middle region of human SMARCA2

Aplicação

Rabbit Anti-SMARCA2 can be used for western blot applications at a concentration of 0.5 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

Ações bioquímicas/fisiológicas

SMARCA2 protein is a part of the large adenosine triphosphate (ATP)-dependent chromatin remodeling complex SWItch/sucrose non-fermentable (SWI/SNF), which is required for transcriptional activation of genes normally repressed by chromatin. Members of SWI/SNF family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes.

Sequência

Synthetic peptide located within the following region: VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Minori Koga et al.
Human molecular genetics, 18(13), 2483-2494 (2009-04-14)
Chromatin remodeling may play a role in the neurobiology of schizophrenia and the process, therefore, may be considered as a therapeutic target. The SMARCA2 gene encodes BRM in the SWI/SNF chromatin-remodeling complex, and associations of single nucleotide polymorphisms (SNPs) to
Jeroen K J Van Houdt et al.
Nature genetics, 44(4), 445-449 (2012-03-01)
Nicolaides-Baraitser syndrome (NBS) is characterized by sparse hair, distinctive facial morphology, distal-limb anomalies and intellectual disability. We sequenced the exomes of ten individuals with NBS and identified heterozygous variants in SMARCA2 in eight of them. Extended molecular screening identified nonsynonymous

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica