AV33617
Anti-CLDN9 antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-Claudin 9
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
24 kDa
reatividade de espécies
mouse, horse, bovine, rat, guinea pig, human, dog
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... CLDN9(9080)
Descrição geral
Claudin-9, CLDN9, is a component of tight junction strands. CLDN9 is important for maintenance of sensory cells in the hearing organs. Mutations in the gene are associated with deafness.
Imunogênio
Synthetic peptide directed towards the C terminal region of human CLDN9
Ações bioquímicas/fisiológicas
CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Sequência
Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Xiaowei Zhang et al.
Diagnostic pathology, 13(1), 11-11 (2018-02-07)
Several studies have suggested that claudin proteins, which are the main components of tight junction structures, are related to the regulation of cell polarity and cell differentiation. To explore the expression profiles of the tight junction proteins claudin-2, - 5, - 8
Yoko Nakano et al.
PLoS genetics, 5(8), e1000610-e1000610 (2009-08-22)
Hereditary hearing loss is one of the most common birth defects, yet the majority of genes required for audition is thought to remain unidentified. Ethylnitrosourea (ENU)-mutagenesis has been a valuable approach for generating new animal models of deafness and discovering
Katharina Reinhard et al.
Science (New York, N.Y.), 367(6476), 446-453 (2020-01-04)
Chimeric antigen receptor (CAR)-T cells have shown efficacy in patients with B cell malignancies. Yet, their application for solid tumors has challenges that include limited cancer-specific targets and nonpersistence of adoptively transferred CAR-T cells. Here, we introduce the developmentally regulated
Hongyu Liu et al.
The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology, 30(8), 722-731 (2019-08-17)
We have previously identified a tight junction protein claudin-9 (CLDN9) as an upregulated gene in hepatocellular carcinoma (HCC) through an immunohistochemistry analysis. Here, we explore its function and clinical relevance in human HCC. Stable transfection of the hepatocyte line HL7702
Christian O Chavarría-Velázquez et al.
Immunobiology, 223(1), 38-48 (2017-10-17)
Gastric carcinogenesis has been associated to H. pylori virulence factors that induce a chronic inflammation process. Lipopolysaccharides play a role in chronic inflammatory responses via TLR2- and TLR4-dependent signaling pathways. Similarly, cellular invasiveness, metastatic potential and prognosis are usually associated
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica