AV31673
Anti-FGD1 antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Anti-FYVE, RhoGEF and PH domain containing 1 (faciogenital dysplasia)
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
107 kDa
reatividade de espécies
human
concentração
0.5 mg - 1 mg/mL
técnica(s)
immunohistochemistry: suitable
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
Informações sobre genes
human ... FGD1(2245)
Descrição geral
Facio-genital dysplasia protein (FGD1) is an upstream regulator of Rho GTPases and is involved in the normal development of embryos. It is also known to function as a guanine-nucleotide exchange factor which is specific for Cdc42Hs. FGD1 mutations have been implicated in Aarskog syndrome.
Rabbit Anti-FGD1 antibody recognizes canine, bovine, human, mouse, and rat FGD1.
Rabbit Anti-FGD1 antibody recognizes canine, bovine, human, mouse, and rat FGD1.
Imunogênio
Synthetic peptide directed towards the C terminal region of human FGD1
Aplicação
Rabbit Anti-FGD1 antibody has been used for western blotting assays at a concentration of 2.0μg/ml.
Ações bioquímicas/fisiológicas
FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.
Sequência
Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
M F Olson et al.
Current biology : CB, 6(12), 1628-1633 (1996-12-01)
Dbl, a guanine nucleotide exchange factor (GEF) for members of the Rho family of small GTPases, is the prototype of a family of 15 related proteins. The majority of proteins that contain a DH (Dbl homology) domain were isolated as
C E Schwartz et al.
European journal of human genetics : EJHG, 8(11), 869-874 (2000-11-28)
The Aarskog syndrome or facio-genital dysplasia (FGDY, MIM No. 305400) is an X-linked condition characterized by short stature, macrocephaly, facial, genital and skeletal anomalies. It is caused by mutation of the FGD1 gene mapped to the Xp11.21 region. To date
Y Zheng et al.
The Journal of biological chemistry, 271(52), 33169-33172 (1996-12-27)
The Rho family of small GTP-binding proteins plays important roles in the regulation of actin cytoskeleton organization and cell growth. Activation of these GTPases involves the replacement of bound GDP with GTP, a process catalyzed by the Dbl-like guanine-nucleotide exchange
Peng Hou et al.
Cell cycle (Georgetown, Tex.), 11(2), 286-295 (2011-12-23)
Although BRAF(V600E) is well known to play an important role in the tumorigenesis of melanoma, its molecular mechanism, particularly the epigenetic aspect, has been incompletely understood. Here, we investigated the role of BRAF(V600E) signaling in altering gene methylation in the
Peng Hou et al.
Endocrine-related cancer, 18(6), 687-697 (2011-09-23)
The BRAF V600E mutation plays an important role in the tumorigenesis of papillary thyroid cancer (PTC). To explore an epigenetic mechanism involved in this process, we performed a genome-wide DNA methylation analysis using a methylated CpG island amplification (MCA)/CpG island
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica