AV100955

Anti-MBP-1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-CIRIP, Anti-HGNC:4920, Anti-MBP-1, Anti-PRDII-BF1, Anti-ZNF40
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 47 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002105
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... MBP-1(3096)

Descrição

Descrição geral

Immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/Myc promoter-binding protein-1 (HIVEP1, CIRIP, MBP-1, ZNF40, PRDII-BF1) is a transcription factor involved in the activation of HIV-1 gene expression and the repression of c-myc gene expression.

Imunogênio

Synthetic peptide directed towards the middle region of human ENO1

Aplicação

Rabbit polyclonal anti-MBP-1 antibody is used to tag immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 in HIV-1 and c-myc gene expression. Anti-MBP-1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Rabbit polyclonal anti-MBP-1 antibody reacts with human immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 transcription factor.

Ações bioquímicas/fisiológicas

MBP-1 binds to the GGGACTTTCC sequence motif found in enhancer elements of viral promoters. It regulates the transcription of both cellular and viral (HIV-1) genes.

Sequência

Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable