Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

AV09021

Sigma-Aldrich

Anti-CAV3 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Caveolin 3

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

17 kDa

reatividade de espécies

bovine, human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_203123

nº de adesão UniProt

P56539

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CAV3(859)

Imunogênio

Synthetic peptide directed towards the N terminal region of human CAV3

Aplicação

Anti-CAV3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Ações bioquímicas/fisiológicas

Caveolin-3 is a membrane protein that binds to the Ca(2+)-release channel, RyR1 and facilitates caveolae formation and Ca+2 homeostasis. CAV3 regulates human ether-a-go-go-related gene (hERG) channels that controls cardiac repolarization.

Descrição-alvo

CAV-3 is a meber of the caveolin family of proteins. It functions as a scaffolding protein caveolin-interacting components and is found highly expressed in muscle.

Sequência

Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC0186

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Jun Guo et al.
The Journal of biological chemistry, 287(40), 33132-33141 (2012-08-11)
The human ether-a-go-go-related gene (hERG) encodes the rapidly activating delayed rectifier potassium channel (I(Kr)) which plays an important role in cardiac repolarization. A reduction or increase in hERG current can cause long or short QT syndrome, respectively, leading to fatal
Gareth Whiteley et al.
The Journal of biological chemistry, 287(48), 40302-40316 (2012-10-17)
Caveolin-3 facilitates both caveolae formation and a range of cell signaling pathways, including Ca(2+) homeostasis. Caveolin-3 forms a disc-shaped nonamer that binds the Ca(2+)-release channel, RyR1. Multiple caveolin-3 nonamers bind to a single RyR1 homotetramer. First three-dimensional structural insights into
Fan Deng et al.
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology, 44(1), 279-292 (2017-11-14)
Hearts from diabetic subjects are susceptible to myocardial ischemia reperfusion (I/R) injury. Propofol has been shown to protect against myocardial I/R injury due to its antioxidant properties while the underlying mechanism remained incompletely understood. Thus, this study aimed to determine

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica