Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

AV09002

Sigma-Aldrich

Anti-SerPINH1 antibody produced in rabbit

IgG fraction of antiserum

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

46 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunoprecipitation (IP): suitable
western blot: suitable

nº de adesão NCBI

NP_001226

nº de adesão UniProt

P50454

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SERPINH1(871)

Imunogênio

Synthetic peptide directed towards the C terminal region of human SERPINH1

Aplicação

Anti- SerPINH1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

SerPINH1 (Hsp47) is a molecular chaperone that regulates protein folding of type I and type IV procollagen in the endoplasmic reticulum. The activity of Hsp47 is critical for the development of well-organized cartilage and formation of normal endochondral bone.

Sequência

Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC0005

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Yusaku Masago et al.
Journal of cell science, 125(Pt 5), 1118-1128 (2012-04-12)
Heat shock protein 47 kDa (Hsp47) is considered as a molecular chaperone essential for the correct folding of type I and type IV procollagen in the ER. However, the function of Hsp47 for other types of procollagen and its importance
Christine Widmer et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(33), 13243-13247 (2012-08-01)
Collagen is the most abundant protein in animals and is a major component of the extracellular matrix in tissues such as skin and bone. A distinctive structural feature of all collagen types is a unique triple-helical structure formed by tandem

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica