Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

Visualizar Toda a Documentação

860381P

Avanti

14:0 PG-d54

Avanti Research™ - A Croda Brand 860381P, powder

Sinônimo(s):

1,2-dimyristoyl-d54-sn-glycero-3-[phospho-rac-(1-glycerol)] (sodium salt)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Fórmula empírica (Notação de Hill):
C34H12O10PNaD54
Número CAS:
326495-45-8
Peso molecular:
743.18
Número MDL:
MFCD00674398
Código UNSPSC:
12352100
NACRES:
NA.25

Ensaio

>99% (TLC)

Formulário

powder

embalagem

pkg of 1 × 10 mg (860381P-10mg)
pkg of 1 × 100 mg (860381P-100mg)

fabricante/nome comercial

Avanti Research™ - A Croda Brand 860381P

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

cadeia de caracteres SMILES

[H][C@@](COP([O-])(OCC(O)CO)=O)(OC(C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])=O)COC(C([2H])([2H])C([2H])([2H])C([2H])([2H])

Categorias relacionadas

Descrição geral

14:0 PG-d54 is a deuterated phosphoglycerol (PG) wherein 54 protons of dimyristoyl are replaced by deuterium.
Deuterated fatty acids experience exchange of the deuteriums on the alpha carbon to the carbonyl, i.e., C2 position, and will therefore be a mixture of compounds that are fully deuterated and partially deuterated at that position.

Aplicação

14:0 PG-d54 may be used to study the unspecific interaction of a phospholipid membrane with endotoxins.

Embalagem

5 mL Amber Glass Screw Cap Vial (860381P-100mg)
5 mL Amber Glass Screw Cap Vial (860381P-10mg)

Informações legais

Avanti Research is a trademark of Avanti Polar Lipids, LLC

Código de classe de armazenamento

11 - Combustible Solids

Classe de risco de água (WGK)

WGK 3

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Se precisar de ajuda, entre em contato Atendimento ao cliente

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Lipopolysaccharide-binding protein-mediated interaction of lipid A from different origin with phospholipid membranes Invited Lecture
Gutsmann T, et al.
Physical Chemistry Chemical Physics, 2(20), 4521-4528 (2000)
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Chris Miranda et al.
Langmuir : the ACS journal of surfaces and colloids, 34(39), 11759-11771 (2018-09-11)
SP-B63-78, a lung surfactant protein fragment, and magainin 2, an antimicrobial peptide, are amphipathic peptides with the same overall charge but different biological functions. Deuterium nuclear magnetic resonance has been used to compare the interactions of these peptides with dispersions
Nicole Harmouche et al.
Biophysical journal, 115(6), 1033-1044 (2018-09-10)
A synergistic enhancement of activities has been described for the amphipathic cationic antimicrobial peptides magainin 2 and PGLa when tested in antimicrobial assays or in biophysical experiments using model membranes. In the presence of magainin 2, PGLa changes from an

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica