SAB2109233

Anti-APBB1 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : APBB1, FE65, RIR
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 78 kDa
• Réactivité de l'espèce (prédite par homologie): human
• Concentration: 0.5 mg/mL
• Technique(s): western blot: 1 μg/mL
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... APBB1(57396)

Description

Description générale

The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer′s disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product′s nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer′s disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogène

Synthetic peptide directed towards the N-terminal region of Human APBB1

Séquence

Synthetic peptide located within the following region: QALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDS

Forme physique

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable