MSST0059

SILu^™Prot CST3, Cystatin C human

recombinant, expressed in E. coli, SIL MS Protein Standard, ¹⁵N-labeled

• Synonyme(s) : CST3, Cystatin C
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.32

Propriétés

• Produit recombinant: expressed in E. coli
• Niveau de qualité: 200
• Pureté: ≥95% (SDS-PAGE)
• Forme: lyophilized powder
• Puissance: ≥97% (Heavy amino acids incorporation efficiency by MS)
• Adéquation: suitable for mass spectrometry (standard)
• Numéro d'accès UniProt: P01034 (aa 27-146)
• Conditions d'expédition: ambient
• Température de stockage: −20°C
• Informations sur le gène: human ... CST3(1471)

Description

Description générale

SILu^™Prot CST3 is a recombinant, stable ¹⁵N isotope-labeled human CST3. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of CST3 in mass-spectrometry. SILu^™Prot CST3 is a protein of 120 amino acids, with a calculated molecular mass of 13.5 kDa.

Actions biochimiques/physiologiques

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

Séquence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Forme physique

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable