Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

MSST0060

Sigma-Aldrich

SILuLite CST3, Cystatin C human

recombinant, expressed in E. coli, MS Protein Standard

Synonyme(s) :

CST3, Cystatin C

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.32

Produit recombinant

expressed in E. coli

Niveau de qualité

Pureté

≥95% (SDS-PAGE)

Forme

lyophilized powder

Adéquation

suitable for mass spectrometry (internal calibrator)

Numéro d'accès UniProt

Conditions d'expédition

ambient

Température de stockage

−20°C

Informations sur le gène

human ... CST3(1471)

Description générale

SILuLite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILuLite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Actions biochimiques/physiologiques

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

Séquence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Forme physique

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique