Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV39623

Sigma-Aldrich

Anti-CBLL1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

55 kDa

Espèces réactives

bovine, rat, human, mouse, horse, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_079090

Numéro d'accès UniProt

Q75N03

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... CBLL1(79872)

Description générale

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.
Rabbit Anti-CBLL1 antibody recognizes human, mouse, rat, zebrafish, canine, and chicken CBLL1.

Immunogène

Synthetic peptide directed towards the C terminal region of human CBLL1

Application

Rabbit Anti-CBLL1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Actions biochimiques/physiologiques

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 also have been predicted as a regulator of cell proliferation.

Séquence

Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Maohong Cao et al.
Journal of molecular histology, 44(2), 135-145 (2012-11-20)
CBLL1 (Casitas B-lineage lymphoma-transforming sequence-like protein 1) also known as Hakai, was originally identified as an E3 ubiquitin-ligase for the E-cadherin complex. Recent data have provided evidences for novel biological functional role of CBLL1 during tumor progression and other diseases.
Maria-Dolores Fernandez-Garcia et al.
Journal of virology, 85(6), 2980-2989 (2010-12-31)
The ubiquitin ligase CBLL1 (also known as HAKAI) has been proposed to be a critical cellular factor exploited by West Nile virus (WNV) for productive infection. CBLL1 has emerged as a major hit in a recent RNA interference screen designed

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique